Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_054254745.1 BN2503_RS00880 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_001298675.1:WP_054254745.1 Length = 259 Score = 242 bits (617), Expect = 7e-69 Identities = 129/250 (51%), Positives = 171/250 (68%), Gaps = 2/250 (0%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 + + KR+G HEVL+GVSL+ +G+V+++IG SGSGKST LRC+N LE D G IT++ Sbjct: 11 IDARDLRKRFGHHEVLRGVSLSVARGEVVAVIGPSGSGKSTFLRCLNHLETIDGGQITIE 70 Query: 87 GISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAA 146 G + + R P + Q++ + + MVFQHFNL+ H+TVLEN+ AP V V+ Sbjct: 71 GEVLASTDAQGHCRYPAEAQVRRICAKTGMVFQHFNLFPHLTVLENLIEAPLVVQGVARD 130 Query: 147 EAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPE 206 A RA LDKVGL ++ D YPA LSGGQ+QRVAIARAL MEP+I+LFDEPTSALDPE Sbjct: 131 VAVARAEKLLDKVGLSAK-RDNYPARLSGGQKQRVAIARALCMEPDIMLFDEPTSALDPE 189 Query: 207 LVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VEEHGDARILDQPNSE 265 L GEVL+ ++ LA+E TML+VTHEMGFAR+V+ +V F+ G +E+ A QP Sbjct: 190 LTGEVLRTMRELAQEHMTMLVVTHEMGFAREVAHRVAFMDGGELIEQAPAAEFFAQPRHA 249 Query: 266 RLQQFLSNRL 275 R + FL + L Sbjct: 250 RTRAFLQSML 259 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 259 Length adjustment: 25 Effective length of query: 251 Effective length of database: 234 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory