Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_082366659.1 BN2503_RS17290 ATP-binding cassette domain-containing protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_001298675.1:WP_082366659.1 Length = 393 Score = 169 bits (428), Expect = 9e-47 Identities = 99/219 (45%), Positives = 138/219 (63%), Gaps = 12/219 (5%) Query: 37 GEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLDGISIEMRQGR 96 G + L +SL G + +IG SG+GKS++LR IN LEQP +G + +DG+ I Sbjct: 57 GTVQALDAISLEIAPGSIFGIIGRSGAGKSSLLRTINRLEQPTSGQVLVDGVDI------ 110 Query: 97 AGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAAEAEKRARMYL 156 GT + + L LR R+ M+FQHFNL S TV EN+ + P +V V AA+ R + L Sbjct: 111 -GTLS--EAGLVQLRRRIGMIFQHFNLLSAKTVAENVAL-PLKVAGVPAAQIAARVQELL 166 Query: 157 DKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPELVGEVLKVIQ 216 VGL + AD YP+ LSGGQ+QRV +ARALA PEI+L DE TSALDPE +L++++ Sbjct: 167 LLVGLQDK-ADTYPSRLSGGQKQRVGVARALATGPEILLCDEATSALDPETTHSILQLLR 225 Query: 217 TLAEE-GRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHG 254 + G T++++THEM R+++ QVL L QGR+ E G Sbjct: 226 DINRTLGITVVLITHEMSVIREIADQVLVLEQGRIAELG 264 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 393 Length adjustment: 28 Effective length of query: 248 Effective length of database: 365 Effective search space: 90520 Effective search space used: 90520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory