Align Histidine transport system permease protein HisM (characterized)
to candidate WP_054254772.1 BN2503_RS00925 ABC transporter permease subunit
Query= SwissProt::P0AEU3 (238 letters) >NCBI__GCF_001298675.1:WP_054254772.1 Length = 229 Score = 95.9 bits (237), Expect = 6e-25 Identities = 63/214 (29%), Positives = 112/214 (52%), Gaps = 12/214 (5%) Query: 22 GVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLFTYIFRGTP-LYVQLLVFYS 80 G +T+ + + S+ + ++ L A ++S + + + +T + RG P L + LL+FY Sbjct: 11 GSLLTVAVSLASLAVATLIGLLGAAAKLSGRRPLVWLASSYTTVVRGIPELLMMLLIFYG 70 Query: 81 GMYTLEIVKGTEFLNAF-FRSGLNCT-----VLALTLNTCAYTTEIFAGAIRSVPHGEIE 134 G L L AF + G++ VL + AY TE F GAI ++P G++E Sbjct: 71 GAIGLN-----NLLEAFGYEEGVDLDPFIAGVLTIGFIYGAYMTETFRGAILAIPKGQME 125 Query: 135 AARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINA 194 AA A+G + + I LP +R ALP+++N ++++ +TAL + D+ +A+ +A Sbjct: 126 AAWAFGMGRAQTFVRITLPQMVRYALPSFTNNWLVLIKATALVSLIGLHDMTYLAKQSSA 185 Query: 195 ATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRW 228 A +PF F A LYL+ + + + RR +R+ Sbjct: 186 AVREPFAFFLFTAALYLVYTSLSLWALRRLSERY 219 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 229 Length adjustment: 23 Effective length of query: 215 Effective length of database: 206 Effective search space: 44290 Effective search space used: 44290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory