Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_082366659.1 BN2503_RS17290 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_001298675.1:WP_082366659.1 Length = 393 Score = 159 bits (402), Expect = 1e-43 Identities = 94/258 (36%), Positives = 152/258 (58%), Gaps = 4/258 (1%) Query: 18 DLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFE 77 D+ K + ++A+D IS+EI G G++G SG GKS+L RTI +L +P G++ + Sbjct: 47 DVAKTYRSSAGTVQALDAISLEIAPGSIFGIIGRSGAGKSSLLRTINRLEQPTSGQVLVD 106 Query: 78 GKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVE 137 G DI L++ + R+++ +IFQ +L TV + PL + + + RV+ Sbjct: 107 GVDIGTLSEAGLVQLRRRIGMIFQH--FNLLSAKTVAENVALPLKVAGVPAA-QIAARVQ 163 Query: 138 ELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIID 197 ELL +VG+ ++ +++P SGGQ+QR+G+ARALA P+ ++CDE SALD I+ Sbjct: 164 ELLLLVGL-QDKADTYPSRLSGGQKQRVGVARALATGPEILLCDEATSALDPETTHSILQ 222 Query: 198 LLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALL 257 LL +I + +GI+ + I H ++V+ I+ +V V+ G+I E G V ++F NP H TRALL Sbjct: 223 LLRDINRTLGITVVLITHEMSVIREIADQVLVLEQGRIAELGAVWQVFGNPQHAATRALL 282 Query: 258 KSVPKIPWDGQKQRFYSL 275 + D +QR +L Sbjct: 283 APLQHGLPDDLQQRLQAL 300 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 393 Length adjustment: 29 Effective length of query: 299 Effective length of database: 364 Effective search space: 108836 Effective search space used: 108836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory