Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_054339946.1 Nant_RS01890 acetyl-CoA C-acyltransferase
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_001305295.1:WP_054339946.1 Length = 394 Score = 489 bits (1258), Expect = e-143 Identities = 255/391 (65%), Positives = 297/391 (75%), Gaps = 1/391 (0%) Query: 4 EVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEPR 63 +VV +SGVRTAIG FGGSLK P EL A VV EA+ R+ V GH V GNVI TE R Sbjct: 5 DVVFLSGVRTAIGGFGGSLKTKTPCELAAAVVEEAVKRSGVEPAAFGHSVIGNVIHTERR 64 Query: 64 DMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSRA 123 DMY+GRVAAVNGG+ P LTVNRLCGSGLQAI++AAQ I LG A+ GGAE MSR+ Sbjct: 65 DMYIGRVAAVNGGLPHETPGLTVNRLCGSGLQAIITAAQQIELGQCSAAVAGGAEVMSRS 124 Query: 124 PYLAPAARWGARMGDAGLVDMMLGALHDPFHRIHMGVTAENVAKEYDISRAQQDEAALES 183 Y P+AR+G RMGDA +VD M+GAL PF HMG+TAENVA+++ ISR QD AL S Sbjct: 125 QYWIPSARFGQRMGDAEIVDAMVGALTCPFDDTHMGITAENVAEKWKISREDQDALALLS 184 Query: 184 HRRASAAIKAGYFKDQIVPVVSKGRKGDVTFDTDEHVRHDATIDDMTKLRPVFVKENGTV 243 H+RA AA +G FKDQI+P+ K RKG FDTDEH R T++DMTKLRP F K +G+V Sbjct: 185 HQRAEAATTSGRFKDQILPIELKSRKGSTFFDTDEHTRKGCTLEDMTKLRPAF-KRDGSV 243 Query: 244 TAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGPVPATKIALE 303 TAGNASGLNDAAAAV +M EA +RGLKP+ARL Y AGV+PK MGIGP+PA + L+ Sbjct: 244 TAGNASGLNDAAAAVTLMSSDEAAKRGLKPMARLAGYAFAGVEPKYMGIGPIPAVRKLLD 303 Query: 304 RAGLQVSDLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALITVKA 363 AGL +SD+DV E NEAFAAQA AV + L L KVN NGSG+SLGHPIGATGA+ITVKA Sbjct: 304 NAGLSISDIDVWEVNEAFAAQALAVARDLDLPADKVNVNGSGVSLGHPIGATGAIITVKA 363 Query: 364 LHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 L+EL RV+GRYA+VTMCIGGGQGIAA+ ERI Sbjct: 364 LYELQRVEGRYAVVTMCIGGGQGIAALLERI 394 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory