Align alcohol dehydrogenase [NAD(P)+] (EC 1.1.1.71) (characterized)
to candidate WP_054340851.1 Nant_RS06010 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::Q8H0L8 (359 letters) >NCBI__GCF_001305295.1:WP_054340851.1 Length = 349 Score = 317 bits (811), Expect = 4e-91 Identities = 164/348 (47%), Positives = 233/348 (66%), Gaps = 9/348 (2%) Query: 16 WATRHTSGVLSPFNFSRRVTGEKHVQFKVMYCGICHSDLHQLKNEWGNTKYPMVPGHEVV 75 +A + + ++P N RR V ++YCG+CHSD+HQ +N+WGN+ YP+VPGHE++ Sbjct: 5 YAAQTATSKMAPLNIQRRTLRPDDVAIDILYCGVCHSDIHQAENDWGNSIYPVVPGHEII 64 Query: 76 GVVIEVGSKVEKFKVGDKVGVGCMVGSCRKCENCTVDLENYCPR-QIPTYNGYS-LDGTL 133 G V +G V ++KVGD VGVGCMV SC C +C LE YC + TYNG DGTL Sbjct: 65 GRVTSIGPNVTQYKVGDIVGVGCMVDSCCSCSSCHAGLEQYCENGMVGTYNGKDYYDGTL 124 Query: 134 TFGGYSDMMVSDEHFVVRWPENLSMD-AAPLLCAGITTYSPLKYFGLDKPGMHIGVVGLG 192 T GGYS+ +V E FV+ P+ L + AAPLLCAGITTYSPLK++G+ K G +G++G+G Sbjct: 125 TSGGYSEHIVVREAFVLSIPDTLDIKAAAPLLCAGITTYSPLKHYGV-KAGDKVGILGMG 183 Query: 193 GLGHMAVKFAKAFGTKVTVISTSANKKQEAIERLGADSFLISRDPEQMKAAMNTLDGIID 252 GLGHM VK+AKA G +VTV + S +K EA + LGAD ++S D +QM AA T + ++D Sbjct: 184 GLGHMGVKYAKALGAEVTVFTRSQSKVAEA-KLLGADHVIVSTDADQMAAATLTFNFLLD 242 Query: 253 TVSAVHPILPLLMLMKSHGKLVMVGAPEKPVELPVF--PLLMGRKLVAGSCIGGMKETQE 310 T+ H P L +K G ++VG ++ P++ L+ R+++AGS IGG+ ETQE Sbjct: 243 TIPVAHDFNPYLNCLKVDGAHIIVGL-VTGIDPPIWGASLITKRRILAGSMIGGIAETQE 301 Query: 311 MLDFAAKHNITPDIEVVPMDYVNTALERLLKSDVKYRFVLDIGNTLNK 358 ML+F+A+H I ++E++ + +N A ER+ K DVKYRFV+D+ N+L K Sbjct: 302 MLNFSAEHGINCEVEMLDIQNINVAYERMKKGDVKYRFVIDM-NSLKK 348 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 349 Length adjustment: 29 Effective length of query: 330 Effective length of database: 320 Effective search space: 105600 Effective search space used: 105600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory