Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate WP_054340851.1 Nant_RS06010 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::Q38707 (365 letters) >NCBI__GCF_001305295.1:WP_054340851.1 Length = 349 Score = 325 bits (833), Expect = 1e-93 Identities = 165/342 (48%), Positives = 232/342 (67%), Gaps = 7/342 (2%) Query: 16 WAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIV 75 +AA+ T ++P RR DV + +L+CGVCHSD H N+WG + YP+VPGHEI+ Sbjct: 5 YAAQTATSKMAPLNIQRRTLRPDDVAIDILYCGVCHSDIHQAENDWGNSIYPVVPGHEII 64 Query: 76 GVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCEN-TIDTY-GSIYFDGTM 133 G VT +G V + KVGD VG+GC+V SC SC SC E +CEN + TY G Y+DGT+ Sbjct: 65 GRVTSIGPNVTQYKVGDIVGVGCMVDSCCSCSSCHAGLEQYCENGMVGTYNGKDYYDGTL 124 Query: 134 THGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLG 193 T GGYS+ +V E F+L P L + + APLLCAGITTYSPLK+YG+ K G K+G++G+G Sbjct: 125 TSGGYSEHIVVREAFVLSIPDTLDIKAAAPLLCAGITTYSPLKHYGV-KAGDKVGILGMG 183 Query: 194 GLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSLDGIID 253 GLGH+ VK AKA GA+VTV S+SK EA + LGAD ++++D +QM A + + ++D Sbjct: 184 GLGHMGVKYAKALGAEVTVFTRSQSKVAEA-KLLGADHVIVSTDADQMAAATLTFNFLLD 242 Query: 254 TVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVF--SLLKGRKLLGGTINGGIKETQE 311 T+PV H P + LK +G ++VG + P++ SL+ R++L G++ GGI ETQE Sbjct: 243 TIPVAHDFNPYLNCLKVDGAHIIVGL-VTGIDPPIWGASLITKRRILAGSMIGGIAETQE 301 Query: 312 MLDFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVIDI 353 ML+F+A+H I +VE++ + +N A ER+ K DV+YRFVID+ Sbjct: 302 MLNFSAEHGINCEVEMLDIQNINVAYERMKKGDVKYRFVIDM 343 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 349 Length adjustment: 29 Effective length of query: 336 Effective length of database: 320 Effective search space: 107520 Effective search space used: 107520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory