Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_054339946.1 Nant_RS01890 acetyl-CoA C-acyltransferase
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_001305295.1:WP_054339946.1 Length = 394 Score = 307 bits (787), Expect = 3e-88 Identities = 178/394 (45%), Positives = 242/394 (61%), Gaps = 11/394 (2%) Query: 9 GIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAGEDNRNVA 68 G+RT IG +GG+L + +LAA + E + R+ ++ ++G + + Sbjct: 11 GVRTAIGGFGGSLKTKTPCELAAAVVEEAVKRSG-VEPAAFGHSVIGNVIHTERRDMYIG 69 Query: 69 RMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMSRAPFVMG 128 R+A + GLP G T+NRLCGSGL A+ AA+ I+ G +AGG E MSR+ + + Sbjct: 70 RVAAVNGGLPHETPGLTVNRLCGSGLQAIITAAQQIELGQCSAAVAGGAEVMSRSQYWIP 129 Query: 129 KAASAFSR-QAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISREDQDSFALR 187 A AE+ D +G + F M TAENVAE KISREDQD+ AL Sbjct: 130 SARFGQRMGDAEIVDAMVG------ALTCPFDDTHMGITAENVAEKWKISREDQDALALL 183 Query: 188 SQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKAPFRANGV 247 S QR A +SG ++I+P+ LK++KG T DEH R TLE + L+ F+ +G Sbjct: 184 SHQRAEAATTSGRFKDQILPIELKSRKGS-TFFDTDEHTRKGCTLEDMTKLRPAFKRDGS 242 Query: 248 ITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPVPATRRVL 307 +TAGNASG+ND AAA+ + S AA +GL P AR+ A AGVEP+ MG+GP+PA R++L Sbjct: 243 VTAGNASGLNDAAAAVTLMSSDEAAKRGLKPMARLAGYAFAGVEPKYMGIGPIPAVRKLL 302 Query: 308 ERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLGMSGARLA 367 + AGLSI D+DV E+NEAFAAQAL V R+L LP D VN NG ++LGHP+G +GA + Sbjct: 303 DNAGLSISDIDVWEVNEAFAAQALAVARDLDLPAD--KVNVNGSGVSLGHPIGATGAIIT 360 Query: 368 LAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 + A +EL R GRYA+ TMCIG GQGIA +LER+ Sbjct: 361 VKALYELQRVEGRYAVVTMCIGGGQGIAALLERI 394 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory