Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_054342057.1 Nant_RS12790 carbohydrate kinase
Query= reanno::Dyella79:N515DRAFT_1919 (326 letters) >NCBI__GCF_001305295.1:WP_054342057.1 Length = 330 Score = 264 bits (674), Expect = 3e-75 Identities = 142/323 (43%), Positives = 199/323 (61%), Gaps = 7/323 (2%) Query: 3 RNILCFGEALIDFHAE------GRDAQGFPRSFIPFAGGAPANVSVAVARLGGPAAFAGM 56 + ++ FGEAL+D + G+ SF F GGAPANV+ AV +LGG + F G Sbjct: 2 QKVISFGEALVDMLSSKVSKPAGKTEAASHESFTKFPGGAPANVAAAVGKLGGNSVFVGQ 61 Query: 57 LGQDMFGDFLLDSLRRAGVDTAGVARTGEANTALAFVALDSHGERSFSFYRPPSADLLFR 116 +G DMFGDF+ SL AGVDT + ++ E TALAFV+LD HGERSF FYR SADLLF Sbjct: 62 VGADMFGDFMKASLEDAGVDTRYLLQSDEGKTALAFVSLDDHGERSFEFYRNASADLLFS 121 Query: 117 PEHFRAESFRGAAVFHVCSNSMTEPALAEATREGMRRAHTAGAWVSFDLNLRPALWPNQS 176 + F+ F G +FH CSN++TEPA+ AT G+ +A +AG +SFD+NLR LWP + Sbjct: 122 ADDFQESCFEGGGLFHFCSNTLTEPAIRAATLAGIDKAKSAGCIISFDVNLRLNLWPEGA 181 Query: 177 ASHDELWPALHLADVVKLSAEEFHWLAGDEGEEATLDRLWAGRARLLVVTDGSRTLRWFH 236 + +W L AD+VKL EE +++ + + ++RL + L++VTDG + LR+ Sbjct: 182 DPFEFIWACLERADIVKLCVEELNFICRGQVQAQVIERLLSLGIALVLVTDGGKPLRYHT 241 Query: 237 PDASGEMPVYAVPTVDSTAAGDAFVGGLLHRLATVEKGADQLDHLVA-ELPRLHAMLRFA 295 + +G + +V VDSTAAGDAF+GGLL+ LA A L VA E L + L FA Sbjct: 242 QERTGTIQPPSVAMVDSTAAGDAFIGGLLYALAEQNISAPLLSDFVAIESALLKSALTFA 301 Query: 296 AACGALTVTRLGSFAAMPDEAEV 318 +ACGA V G+F+++P + ++ Sbjct: 302 SACGAYAVAHQGAFSSLPGKEDL 324 Lambda K H 0.322 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 330 Length adjustment: 28 Effective length of query: 298 Effective length of database: 302 Effective search space: 89996 Effective search space used: 89996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory