Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_045585723.1 AL072_RS26030 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >NCBI__GCF_001305595.1:WP_045585723.1 Length = 249 Score = 119 bits (298), Expect = 6e-32 Identities = 83/247 (33%), Positives = 130/247 (52%), Gaps = 8/247 (3%) Query: 22 LVDRTVLITGGAT--GIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPLFLS 79 L ++ +ITG A+ GIG + FA G R D+D + A ELG++ + Sbjct: 3 LSNKVCVITGAASRRGIGKATARLFALHGGRAIILDLDGAQAAEAAAELGEAHRG---FA 59 Query: 80 CDLTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRHQFFA 139 CD+TD DA A V G I VLVNNA + ++ ++++A V++R + Sbjct: 60 CDVTDRDACFAAATRVVEEFGRIDVLVNNAGITQPLKFMDIGPKNYEAVTDVSLRGTLYM 119 Query: 140 AQAVMEDMKAANSGSIINLGSISWMLKNG--GYPVYVMSKSAVQGLTRGLARDLGHFNIR 197 +QAV+ M+ +GSI+ + S+S G G P Y +K+ V GL + +AR+LG N+R Sbjct: 120 SQAVVPHMRERKAGSIVCISSVSAQRGGGIFGGPHYSAAKAGVLGLAKAMARELGPDNVR 179 Query: 198 VNTLVPGWVMTEKQKRLWLDDAGRRSIKEGQCIDAELEPADLARMALFLAADDSRMITAQ 257 VN++ PG + T+ L D R I +G ++ + D+AR LFLA++ S IT Sbjct: 180 VNSVTPGLIQTDITGGK-LTDELRTEILKGIPLNRLGDAEDVARSCLFLASELSSYITGA 238 Query: 258 DIVVDGG 264 + V+GG Sbjct: 239 TLDVNGG 245 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 249 Length adjustment: 24 Effective length of query: 242 Effective length of database: 225 Effective search space: 54450 Effective search space used: 54450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory