Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_045585972.1 AL072_RS28230 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_001305595.1:WP_045585972.1 Length = 271 Score = 184 bits (467), Expect = 2e-51 Identities = 104/273 (38%), Positives = 167/273 (61%), Gaps = 10/273 (3%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 + + ++++FGG+ A+ D SF ++G++ ++IGPNGAGKT++ NCI+G Y+PT G + F Sbjct: 1 MFEARGVNLRFGGVHALTDVSFGIRKGELFSIIGPNGAGKTSMVNCISGRYRPTDGKVYF 60 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 + + P+ R + + RTFQN+ LF +TVL+N++V +H+ L+K + T Sbjct: 61 KGRD----VTGMTPNHRAS--LGIGRTFQNLALFGHMTVLDNIMVGRHH-LLKNNFLTGP 113 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 G K E + E+ ++ ++ AG L YG ++R+E+ARA+ P+L+ Sbjct: 114 LYWLTGARKEELSHRREVEEI-IDFLEIQHVRKATAGTLSYGLRKRVELARAIALKPDLI 172 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDEP AG+N E + + + E G ++++IEHDM VVM+IS V+VLE+G+KI++ Sbjct: 173 LLDEPMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVMDISHRVMVLEFGKKIAE 232 Query: 254 GTPDHVKNDPRVIAAYLGVEDEEVEEVIAAVEQ 286 G P+ V DPRV AYLG +D+ EE AA Q Sbjct: 233 GRPEEVLADPRVRRAYLGEDDD--EEAPAAAHQ 263 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 271 Length adjustment: 26 Effective length of query: 266 Effective length of database: 245 Effective search space: 65170 Effective search space used: 65170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory