Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_045586263.1 AL072_RS14545 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_001305595.1:WP_045586263.1 Length = 234 Score = 178 bits (452), Expect = 9e-50 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 25/258 (9%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 +L V+ L F GL+A D F G+I LIGPNGAGKTT+FNC+ GF+ PT G I F Sbjct: 1 MLAVDGLGKAFDGLVANRDIGFTVHHGEIIGLIGPNGAGKTTLFNCLAGFHTPTTGRIAF 60 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 + P+ +ARTFQ +R+F +T LEN++V Sbjct: 61 EGHD----ITGSTPE--AAAALGIARTFQIVRVFHSMTALENVMV--------------- 99 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 G + AEA + A L L+ RAD PA DL Q+RLE+ARA+ T P+L+ Sbjct: 100 ---GAMLRNKRVAEARDRAEQELSFVGLLHRADTPASDLTVSEQKRLEVARALATEPKLI 156 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDE AGLNP E +AL++ I + G + +++EH M +M I+ ++VL+YG KI+D Sbjct: 157 LLDEVMAGLNPTEVREASALVRRIH-QRGIASIIVEHVMEGIMPIAHRMLVLDYGAKIAD 215 Query: 254 GTPDHVKNDPRVIAAYLG 271 GTP + +P VIAAYLG Sbjct: 216 GTPAEIAENPAVIAAYLG 233 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 234 Length adjustment: 25 Effective length of query: 267 Effective length of database: 209 Effective search space: 55803 Effective search space used: 55803 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory