Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_045585962.1 AL072_RS28085 SDR family oxidoreductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_001305595.1:WP_045585962.1 Length = 248 Score = 129 bits (324), Expect = 6e-35 Identities = 89/253 (35%), Positives = 143/253 (56%), Gaps = 15/253 (5%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCD--VSESALAVFRDKYPGTVAT--RADVS 67 G VL++GG +GIG A A+ +AGA V V +E V + + G V + ADV+ Sbjct: 3 GRVVLVTGGTSGIGRATALAFGQAGATVIVTGRREAEGQETVAQIGHAGGVGSFVAADVA 62 Query: 68 DAAQIEAVF-KVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAH 126 DAA++ A+F +++R+H G LD NNAGI + + D+ + + +N+ + Sbjct: 63 DAAEVAALFGRIERDH-GRLDAAFNNAGIH-QVAPLTEMDDSAFDRILTVNVKGVWLCLK 120 Query: 127 HAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNAL 186 H + ++K HG +++ SV G++G A Y+A+K A+ GL ++ A E+ S +RVNA+ Sbjct: 121 HELAIMKRQGHGSIVNTGSVLGQIGMAGNAAYSASKAAVEGLTRTAAIEVAASGVRVNAV 180 Query: 187 LPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAAR 246 P I++ P G AEQV EA + + + + R+ E+VAA L+LCS +A Sbjct: 181 CPAIIQTPMTQGSF-GGAEQV---EAVLGRLH----PVGRVGRPEEVAAAVLWLCSDSAG 232 Query: 247 NVTGQAISVDGNV 259 VTGQ+I++DG V Sbjct: 233 FVTGQSINIDGGV 245 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 248 Length adjustment: 24 Effective length of query: 238 Effective length of database: 224 Effective search space: 53312 Effective search space used: 53312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory