Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_045583776.1 AL072_RS25975 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_001305595.1:WP_045583776.1 Length = 266 Score = 118 bits (295), Expect = 1e-31 Identities = 90/259 (34%), Positives = 136/259 (52%), Gaps = 21/259 (8%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYI-----CDVDPAAIDRARTAHPQLHAGVADV 66 G RVL++G++ GIGAA+A AF+ +GA+V I V+ AA A + P++ A D Sbjct: 20 GKRVLVTGSSRGIGAAVAAAFVQLGAHVAIHGRDMATVEAAAAGMATASGPEVVALAGDF 79 Query: 67 SDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLR 126 +D A+ +++ A +LGGLD+LINNAG A+ D+D +R N S R Sbjct: 80 ADKAETRAVVERAMDRLGGLDVLINNAGTMLGRVALADIDDDFLQRQFDLNAASTVVASR 139 Query: 127 KAVPLLKETSANPGIIAMASVAGRL-GYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVN 185 A+P L ++ I+ S++GR G A Y+A+K + +SLA EL P+ +RVN Sbjct: 140 TALPALIASAG--AIVNTGSISGRTGGSAGSALYSAAKAFQASLARSLATELAPHGIRVN 197 Query: 186 AILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASP- 244 A+ PG + + R + D++ + +I L+R+ T D LFLAS Sbjct: 198 AVSPGTIATDFHQRYSTP---------DKL-SQTAARIPLKRLGTAGDCVGAYLFLASGR 247 Query: 245 -AGQNISGQAISVDGNVEY 262 AG I+GQ I V+G Y Sbjct: 248 LAGY-ITGQVIEVNGGQFY 265 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 266 Length adjustment: 25 Effective length of query: 238 Effective length of database: 241 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory