Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_045585269.1 AL072_RS28915 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_001305595.1:WP_045585269.1 Length = 425 Score = 327 bits (839), Expect = 3e-94 Identities = 168/417 (40%), Positives = 260/417 (62%), Gaps = 2/417 (0%) Query: 9 SFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPFFVLAGAIM 68 +F +L+++G PV ALG ++ + DI L + + +G++ F LL IP FVLAG +M Sbjct: 9 TFAILLILGAPVGIALGGASAVYLVGSDIDLAVVPQFMYAGMDSFVLLCIPGFVLAGNLM 68 Query: 69 AEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLIPEMERK 128 GG++ ++V F+ LVG +RGGL L N+ S F ISG++VA+TAS+G+V+IP M + Sbjct: 69 NGGGITDQIVQFSNRLVGHIRGGLGLANVTGSMVFAGISGTAVAETASIGAVMIPAMRKS 128 Query: 129 GYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLLSAVMMG 188 GY F+ AVT + S + PPS ++ G +S+ +FMAG +PGLLL MM Sbjct: 129 GYDAPFAAAVTAAASTVGPIIPPSVPMIIVGTLTG--LSVGKMFMAGAIPGLLLGVGMML 186 Query: 189 LCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATESAAVAVVW 248 I A+ RNYPK L+ + A W L+ IIL GI+ G FT TE++ VA ++ Sbjct: 187 TVWILARVRNYPKEPWQGFGALLRASRGAFWALLMTAIILFGIVGGYFTPTEASVVAAIY 246 Query: 249 SFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKITTAFLT 308 +F + +F+Y+ + RDLP ++ + +++L+G A FG+++T QIP I + L Sbjct: 247 AFVIGLFVYKGFTLRDLPAILLESAIGSGGLILLVGLANVFGWILTSEQIPQAIAASMLA 306 Query: 309 LSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIMLVNLGI 368 L+ N+Y+I++ IN +L+++GT M+ ++IL P LL V +G+DP+HF ++NL I Sbjct: 307 LTTNKYLIILMINILLLIVGTFMETIAALIILFPPLLAVAVQVGIDPIHFATFAVLNLMI 366 Query: 369 GLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWLPSVV 425 GL TPPVG LFV + I K+S+ + KA+ PF L L+L+ V+Y+PA+SLWLP ++ Sbjct: 367 GLTTPPVGVCLFVAANIAKISLGAITKAIWPFLLCNILILLLVSYVPALSLWLPGLL 423 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 425 Length adjustment: 32 Effective length of query: 394 Effective length of database: 393 Effective search space: 154842 Effective search space used: 154842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory