Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_045585626.1 AL072_RS27695 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_001305595.1:WP_045585626.1 Length = 292 Score = 155 bits (391), Expect = 1e-42 Identities = 92/281 (32%), Positives = 155/281 (55%), Gaps = 4/281 (1%) Query: 4 SQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTS-GINLWLS 62 +Q I NG+ G L A GLTL +G+LR+ NFAHG+F L AY+T++ T G++ + Sbjct: 7 AQQIANGLVNGMAYVLIATGLTLVFGVLRIVNFAHGEFYMLGAYITYFIGTLFGLDYLAA 66 Query: 63 MALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQNYR 122 A+ V L++ P+R R T+++ S+GLAL + NG L++G + + Sbjct: 67 AAISAVVVAGLGIAANKLIFWPLR--RDHEFTILLSSLGLALLIANGGELLFGADPKYVE 124 Query: 123 VPIVPAQDFMG-IKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVSG 181 P +G + R+LV A A+ A+V ++L ++ ++ GK MRA A N D A ++G Sbjct: 125 SPFADEVLEIGTVTLTQQRVLVFAAAVVALVAVYLFIRYSRFGKMMRATAQNPDGAALTG 184 Query: 182 INVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGAIA 241 IN+ V +T+ + L AL G++ G + P +G + +L F VI+GG+G+ GA+ Sbjct: 185 INIGLVHTYTFALACGLAALSGALVGPTVMIFPTIGNWAVLKGFIVVIMGGLGSVTGALF 244 Query: 242 GGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLF 282 G+++GV + + + + + ++I +L RP GLF Sbjct: 245 AGLLLGVIESLGGGYISLGFMEAIGYAMIIAVLLWRPNGLF 285 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 292 Length adjustment: 26 Effective length of query: 260 Effective length of database: 266 Effective search space: 69160 Effective search space used: 69160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory