Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate WP_045584011.1 AL072_RS25820 acetyl-CoA carboxylase biotin carboxylase subunit
Query= BRENDA::Q9I299 (655 letters) >NCBI__GCF_001305595.1:WP_045584011.1 Length = 454 Score = 438 bits (1126), Expect = e-127 Identities = 230/442 (52%), Positives = 305/442 (69%), Gaps = 3/442 (0%) Query: 8 IQRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYL 67 ++R+LVANRGEIA RV+R+ R LGI +V VHS D+ + V AD +V +GG +SYL Sbjct: 1 MRRILVANRGEIALRVIRACRDLGIEAVQVHSSADQDSLPVRLADASVCIGGPSATESYL 60 Query: 68 RGDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKA 127 D +I AA+ +G A+HPGYGFLSENA FAR CEE GL+F+GP A IDAMG K+AA+ Sbjct: 61 NVDALIDAAMRTGCDAVHPGYGFLSENAGFARTCEERGLVFIGPNPAVIDAMGDKAAARR 120 Query: 128 LMEEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEAL 187 + EAGVP+ PG + AG++GYPVL+KA+AGGGG+GM+VV EA L + L Sbjct: 121 IAVEAGVPVSPGSPDPVSGADEAAAIAGKVGYPVLIKASAGGGGRGMRVVADEAALRDTL 180 Query: 188 SSAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEE 247 A EA A+FG+ + +EKYL + RHVE+QV D H +++ ERDCS+QRRHQK+VEE Sbjct: 181 ERASAEAAASFGNGAVYIEKYLPRVRHVEVQVMGD-GDHVVHMGERDCSVQRRHQKLVEE 239 Query: 248 APAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLD-ERGQFFFMEMNTRLQVEHPVT 306 +P+PG+ ++LRR + E+A A+ + Y AGT+EF++D + +FFF+EMNTR+QVEHPVT Sbjct: 240 SPSPGISSDLRRRITESACALARHVRYRSAGTLEFIVDADSEEFFFIEMNTRIQVEHPVT 299 Query: 307 EAITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYRE 366 EA+TGLDLV QI VA LPL QE V +GHAIE R+ AEDP+ FLP G L + Sbjct: 300 EAVTGLDLVKLQIIVADTGILPLRQEDVHFSGHAIECRINAEDPDKGFLPKPGVLKDF-H 358 Query: 367 AAAGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNL 426 A AGPG RVDS G + P+YD +LAK+++WG TREEA R+ LAET V G+ T + Sbjct: 359 APAGPGIRVDSHAYPGYALPPYYDSLLAKIVSWGRTREEAIARMRRALAETRVEGVPTTI 418 Query: 427 AFLRRILGHPAFAAAELDTGFI 448 F +R+L F A + T ++ Sbjct: 419 GFHQRLLSDDRFLAGAVHTRYV 440 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 775 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 454 Length adjustment: 35 Effective length of query: 620 Effective length of database: 419 Effective search space: 259780 Effective search space used: 259780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory