Align Acyl-coenzyme A synthetase ACSM3, mitochondrial; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; EC 6.2.1.2; EC 6.2.1.17 (characterized)
to candidate WP_045584537.1 AL072_RS19855 AMP-binding protein
Query= SwissProt::Q3UNX5 (580 letters) >NCBI__GCF_001305595.1:WP_045584537.1 Length = 538 Score = 303 bits (776), Expect = 1e-86 Identities = 195/548 (35%), Positives = 288/548 (52%), Gaps = 19/548 (3%) Query: 33 NFSNYESMKQDFKIEIPEYFNFAKDVLDQWTNMEKAGKRLSNPAFWWIDGNGEELRWSFE 92 N +Y+ M + F +P+ +N DV D+W E L + DG EE R F Sbjct: 4 NADSYDGMARAFAWRVPDRYNIGVDVCDRWAEAEPDRLALIHMRR---DGGAEEYR--FA 58 Query: 93 ELGLLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGTTQLTQKD 152 ++ LS +FAN L +A + RGDRV ++LP+ PE +++VA + G V +P + + Sbjct: 59 DIRALSNRFANAL-DAQGVVRGDRVGILLPQAPETAVSHVAVYKLGGVAVPLFSLFGVEA 117 Query: 153 ILYRLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQHSREGWGNLKEMMKYASDS 212 + YRL + A+ ++TD A + + + L + + S G + + ASD Sbjct: 118 LEYRLANCGARAVVTDAAGAAKIAQIRDRLPELRAVFRIDG-SGPGCLDWHGLCDAASDD 176 Query: 213 HTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIAS--DVMWNTS 270 T DT D+ I +TSGTTG PK H H LG DL D +W + Sbjct: 177 FTPADTGPDDPALIIYTSGTTGQPKGALHAHRVL-LGHLPGVEMSHDLFPQPGDRIWTPA 235 Query: 271 DTGWAKSAWSSVFSPWTQGACVFAHYLPRFESTSILQTLSKFPITVFCSAPTAYRML-VQ 329 D W + W G V +H +F++ + L++F + PTA +M+ Sbjct: 236 DWAWIGGLLDVLLPAWHHGVTVVSHRFEKFDAEAAFALLAEFQVRNAFLPPTALKMMRAV 295 Query: 330 NDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYGQTETVLICGNFKG-MKIK 388 D + +++ S GE + +++ R+ G+ I E YGQTE +I + M+ K Sbjct: 296 PDPGARHAIAMRSVASGGETLGAGLLDWGRQTFGVTINEFYGQTECNMIVSSAATLMQPK 355 Query: 389 PGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPFG-LFTHYVDNPSKTASTLR 447 PG MG+P P DV ++D +G LPPGQ G IA+ RP +F Y +NP TA+ Sbjct: 356 PGIMGRPVPGHDVAVIDGDGNRLPPGQIGLIAVH----RPDPVMFLGYWNNPDATAAKFI 411 Query: 448 GSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEVESALIEHPSIAESAVVSSPD 507 G++ +TGD+G +D+DGY FV R DD+I S+GYRIGP E+E LI HP+I +AVV PD Sbjct: 412 GNWLVTGDQGELDQDGYIRFVGRDDDVITSAGYRIGPGEIEDCLIGHPAIRMAAVVGVPD 471 Query: 508 PIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPYKYPRKVEFIEELPKTVSGKV 567 P+R E+VKAF+VL D D L IQ+HVK A ++YPR +EF+E LP T +GK+ Sbjct: 472 PLRTEIVKAFVVLQEDVVPDD--ALVASIQQHVKTKLAAHEYPRAIEFVESLPMTTTGKI 529 Query: 568 KRNELRKK 575 R ELR + Sbjct: 530 IRRELRNR 537 Lambda K H 0.319 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 763 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 580 Length of database: 538 Length adjustment: 36 Effective length of query: 544 Effective length of database: 502 Effective search space: 273088 Effective search space used: 273088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory