Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_045580995.1 AL072_RS06645 branched-chain amino acid ABC transporter permease
Query= TCDB::P21628 (417 letters) >NCBI__GCF_001305595.1:WP_045580995.1 Length = 315 Score = 170 bits (430), Expect = 6e-47 Identities = 104/308 (33%), Positives = 167/308 (54%), Gaps = 24/308 (7%) Query: 101 VAFVWPFFASRGAVDIATLILIYVMLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYALLAE 160 +A + F + +DIA L ++ +GLN+++G AG + LG+ GF+ +GAY +L Sbjct: 19 IAVLPAFLPNNFYLDIAILAGFNAVVCVGLNLLIGYAGQISLGHAGFFGIGAYASGVLVG 78 Query: 161 YAGFGFWTALPIAGMMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTEITGG 220 G+ AL + L F + P+LRL+G YLA+ TLG G I+ I+LR + +TGG Sbjct: 79 TYGWPPVLALLAGAAVVGLLAFAVAKPILRLKGHYLAMATLGIGIIVSIVLRTESGLTGG 138 Query: 221 PNGIGSIPKPTLFGLTFERRAPEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVI 280 P+G+ + +FG+ E +G + + +VV +LLV + + Sbjct: 139 PDGM-MVEPFRIFGI--------------ELYG-------EKVWYWVVGVLLVGVVWLSL 176 Query: 281 NRLMRMPIGRAWEALREDEVACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTP 340 N L+ P+GRA A+ EVA +G++ K+ F + A FA AGS FA GL+TP Sbjct: 177 N-LIDSPMGRALRAVHGSEVAAEVVGVDTARFKVLVFVLSAVFASVAGSLFAHYAGLITP 235 Query: 341 ESFTFIESAMILAIVVLGGMGSQLGVILAAVVMVLL-QEMRGFNEYRMLIFGLTMIVMMI 399 F +S ++ +VV GGM S G ++ AVV+ LL Q + F +Y+ ++ G ++ M+ Sbjct: 236 AKADFFKSIELVTMVVFGGMASTFGAVVGAVVLTLLPQALTMFQDYQQIVLGGILMATMV 295 Query: 400 WRPQGLLP 407 + P+GLLP Sbjct: 296 FMPKGLLP 303 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 35 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 315 Length adjustment: 29 Effective length of query: 388 Effective length of database: 286 Effective search space: 110968 Effective search space used: 110968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory