Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_045582953.1 AL072_RS17755 aldehyde dehydrogenase
Query= BRENDA::Q8BH00 (487 letters) >NCBI__GCF_001305595.1:WP_045582953.1 Length = 503 Score = 325 bits (833), Expect = 2e-93 Identities = 181/480 (37%), Positives = 268/480 (55%), Gaps = 12/480 (2%) Query: 14 IGGKFLPCNS--YIDSYDPSTGEVYCKVPNSGKEEIEAAVEAAREAF--PAWSSRSPQER 69 IGG+F+ S YI SYDP+T E + ++ ++G E+++ AV AAR AF PAW + +R Sbjct: 17 IGGRFVEPKSGRYIPSYDPTTAEPWYELADAGPEDVDDAVAAARAAFVDPAWRRMTQSDR 76 Query: 70 SLVLNRLADVLEQSLEELAQAESKDQGKTLTLARTM--DIPRSVLNFRFFASSNLHHVSE 127 ++ RLA+++ + EELA E++D GK + R +P S + +FA + Sbjct: 77 GKLVRRLAELILVNAEELALMETRDNGKLIKEMRAQMRAMPDS---YTYFAGMADKLQGD 133 Query: 128 CTQMSHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSEMTSVTA 187 ++ L +++ +R P+G+ G+I+PWN PL LLT +AP +A GNTV+ KPSE + + Sbjct: 134 TIPVNKLDMLNFNLREPLGVVGMITPWNSPLMLLTGTLAPCLAIGNTVVIKPSEHATAST 193 Query: 188 WMFCKLLDKAGVPPGVINIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHC 247 +L+ +AG P GV+N+V G G GEAL HP + I FTGS T RI +A + Sbjct: 194 LALAELVAEAGFPAGVVNVVSGAGATAGEALTRHPGIAKIVFTGSTQTGSRIAANAAGNL 253 Query: 248 KKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQRSIYSEFLKRF 307 +ELGGK+P ++F D ++E + V FA G+ C+ SR FV+ SIY F++ Sbjct: 254 VPCQMELGGKSPHVVFGDVDIERAVNGVVAGVFAAAGQTCVAGSRCFVEASIYDRFVEAL 313 Query: 308 VEATRKWKVGVPSDPSANMGALISKAHLEKVRSYVLKAQTEGARILCGEGVDQLSLPLRN 367 V T + VG P + ++G L L KV YV Q +GAR+ G Q + Sbjct: 314 VARTGRIAVGHPMEEGTDIGPLALSPQLAKVEEYVASGQRDGARLAAGGRRPQAA---GL 370 Query: 368 QAGYFMLPTVITDIKDESRCMTEEIFGPVTCVVPFDSEEEVITRANSVRYGLAATVWSKD 427 G++ PTV+ D +++ M +EIFGPV VVPF SE+E+I AN RYGLA+ +W+ D Sbjct: 371 DRGWYFEPTVLADARNDMGFMRDEIFGPVVGVVPFASEDEMIAMANDTRYGLASGIWTGD 430 Query: 428 VGRIHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITIKY 487 + R R A ++ +G VW N + GG K SG GR G D F+ K + I Y Sbjct: 431 IDRAMRFATRIDAGTVWINTYRAAAYMSSNGGFKQSGYGRRGGFDVMREFSRSKNVVIDY 490 Lambda K H 0.319 0.134 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 503 Length adjustment: 34 Effective length of query: 453 Effective length of database: 469 Effective search space: 212457 Effective search space used: 212457 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory