Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_045585972.1 AL072_RS28230 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_001305595.1:WP_045585972.1 Length = 271 Score = 201 bits (511), Expect = 1e-56 Identities = 101/254 (39%), Positives = 163/254 (64%), Gaps = 9/254 (3%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 + E + + FGG+ A+ DV+ + +GEL +IGPNGAGKT++ N ++G Y P++G V Sbjct: 1 MFEARGVNLRFGGVHALTDVSFGIRKGELFSIIGPNGAGKTSMVNCISGRYRPTDGKVYF 60 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 G + G +P ASLG+GRTFQN+ LF +TVLDN+++ G HH + +FL P ++ Sbjct: 61 KGRDVTGMTPNHRASLGIGRTFQNLALFGHMTVLDNIMV--GRHHL--LKNNFLTGPLYW 116 Query: 123 -----KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDE 177 K E + + E++ ++ + A LSYG ++R+E+ RA+A +P ++ LDE Sbjct: 117 LTGARKEELSHRREVEEIIDFLEIQHVRKATAGTLSYGLRKRVELARAIALKPDLILLDE 176 Query: 178 PAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPD 237 P AGMN +E ++ I + +EF +T+++IEHDM +VM+++ R+ VLE+G+ IA+G P+ Sbjct: 177 PMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVMDISHRVMVLEFGKKIAEGRPE 236 Query: 238 EIKTNKRVIEAYLG 251 E+ + RV AYLG Sbjct: 237 EVLADPRVRRAYLG 250 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 271 Length adjustment: 25 Effective length of query: 229 Effective length of database: 246 Effective search space: 56334 Effective search space used: 56334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory