Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate WP_045584384.1 AL072_RS22385 citrate synthase
Query= BRENDA::Q9KSC1 (377 letters) >NCBI__GCF_001305595.1:WP_045584384.1 Length = 364 Score = 134 bits (338), Expect = 3e-36 Identities = 80/215 (37%), Positives = 113/215 (52%), Gaps = 12/215 (5%) Query: 162 LKMLTGQAPSELFKKVMHCSLTLYAEHEFNASTFAARVCASTLSDIHSCVTGAIGTLRGP 221 L+M+ G P E +++ L +H NAST ARV AST + + A+G L GP Sbjct: 138 LRMIHGATPGETETRMLDRYLVAMVDHGVNASTLTARVVASTGGGLSAAALAALGALEGP 197 Query: 222 LHGGANEAAMAMIEQWHSADEAEAGIMRMLASKEKIMGFGHAIYRESDPRNALIKEWSKA 281 LHGGA + M++ AD AE ++ LA E++MGFG Y DPR ++K+ A Sbjct: 198 LHGGAPGLVLDMLDAIGKADHAEDWVVAALARGERLMGFGSRAYHIRDPRADIMKDSVLA 257 Query: 282 LSEA----VGDSHLYAVSERVE-------AVMKREKDLFCNADFFHASAYHFMGIPTKLF 330 L + D L A +E VE A + ++ L N +F+ A +G+P F Sbjct: 258 LQRSGASWAPDGRL-AFAETVERTVLSVMASRRPDRPLHTNVEFYAALLLEALGVPRAGF 316 Query: 331 TPIFVMSRLTGWAAHVYEQRANNRIIRPSADYVGP 365 TP+F SR GWAAHV EQ R++RP++ YVGP Sbjct: 317 TPLFAASRAAGWAAHVREQERTGRMLRPTSRYVGP 351 Lambda K H 0.320 0.134 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 364 Length adjustment: 30 Effective length of query: 347 Effective length of database: 334 Effective search space: 115898 Effective search space used: 115898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory