Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_045585962.1 AL072_RS28085 SDR family oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_001305595.1:WP_045585962.1 Length = 248 Score = 137 bits (344), Expect = 3e-37 Identities = 84/244 (34%), Positives = 126/244 (51%), Gaps = 2/244 (0%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVD 75 + G+ VLVTGG SGIG F + GA V AE Q V ++ G F D Sbjct: 1 MSGRVVLVTGGTSGIGRATALAFGQAGATVIVTGRREAEGQETVAQIGHAGGVGSFVAAD 60 Query: 76 LTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQ 135 + D A + A+ R+ + G D NNA + E+ ++ +D L+VN+K ++ C + Sbjct: 61 VADAAEVAALFGRIERDHGRLDAAFNNAGIHQVAPLTEMDDSAFDRILTVNVKGVWLCLK 120 Query: 136 AVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATCV 195 + M+ +G G+IVN GS+ +G++ Y KAA+EGLTR+ A ++ G+R V Sbjct: 121 HELAIMKRQGHGSIVNTGSVLGQIGMAGNAAYSASKAAVEGLTRTAAIEVAASGVRVNAV 180 Query: 196 IPGNVRTPRQLKWYSPEGEAEIVAAQCLD-GRLA-PEDVAAMVLFLASDDARLVTGHSYF 253 P ++TP + + E V + GR+ PE+VAA VL+L SD A VTG S Sbjct: 181 CPAIIQTPMTQGSFGGAEQVEAVLGRLHPVGRVGRPEEVAAAVLWLCSDSAGFVTGQSIN 240 Query: 254 VDAG 257 +D G Sbjct: 241 IDGG 244 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 248 Length adjustment: 24 Effective length of query: 235 Effective length of database: 224 Effective search space: 52640 Effective search space used: 52640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory