GapMind for catabolism of small carbon sources

 

Protein WP_054557366.1 in Croceitalea dokdonensis DOKDO 023

Annotation: NCBI__GCF_001306415.1:WP_054557366.1

Length: 228 amino acids

Source: GCF_001306415.1 in NCBI

Candidate for 36 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 38% 64% 149.8 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 90% 144.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 90% 144.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-glutamate catabolism gltL lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 37% 90% 144.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 84% 144.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 37% 92% 143.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 40% 85% 142.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 40% 85% 142.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 83% 138.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 83% 138.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 36% 84% 138.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 85% 137.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 35% 61% 133.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 60% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 60% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 60% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 60% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 36% 50% 127.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 34% 58% 126.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 37% 61% 126.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 35% 66% 125.2 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 36% 57% 123.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 73% 120.2 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 73% 119.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-mannitol catabolism mtlK lo ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 33% 56% 117.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-sorbitol (glucitol) catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 33% 56% 115.9 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 91% 114 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 91% 114 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 91% 114 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 54% 104.8 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 30% 87% 102.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 44% 206.8

Sequence Analysis Tools

View WP_054557366.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSKILNVTQLGKTYASGNKTLTVLEDVSFSIDTGETFAIVGPSGSGKTTLLGLCAGLDQT
DQGTVHLCGVALNELNEDERALLRNREVGFIFQNFQLLPTLTALENVAVPLELQGQKNTH
GIAAELLEKVGLQDRKHHYPSQLSGGEQQRVALARAFSSTPSILFADEPTGNLDSETGQK
VVELLFDLNKEAGTTLVIVTHDMELAQKTQRILKLKGGKVVTEENQKL

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory