GapMind for catabolism of small carbon sources

 

Protein WP_054559826.1 in Croceitalea dokdonensis DOKDO 023

Annotation: NCBI__GCF_001306415.1:WP_054559826.1

Length: 325 amino acids

Source: GCF_001306415.1 in NCBI

Candidate for 33 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 31% 87% 161.8 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 32% 67% 138.3 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 33% 75% 135.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 58% 132.9 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 63% 129.8 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 63% 129.8 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 63% 129.8 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 33% 63% 129.8 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 33% 64% 127.1 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 60% 120.2 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 97% 113.6 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 31% 66% 110.5 Fe(3+)-transporting ATPase; EC 3.6.3.30 31% 165.2

Sequence Analysis Tools

View WP_054559826.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLAVDSISFSYANKPILKDVSFSIEKGTHLSIMGESGSGKSTLLKAIYGLLELEKGTVFW
GKEQVLGPNYNLVPGEKYMKYVAQDFDLMPFTTVTENIAEHLSAFEMDSHQARITELLHI
IEMEEFAHVKVKNLSGGQQQRVALARALAQEPEVLLLDEPFSSIDQFKKNELRYKLFPYL
REKGITVINASHDPNDVLAFADETIVLKNGEILAHEPTVQLYQIPKEKYVASLFGVVNKV
PITLLKEYSETDKSILIYPHEFMISPNQGFEVYVVNNHFKGSHYLIQGLSNTGFSVFFTN
RNALQVNTQVFLNVSLQLVNKRLNP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory