Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate WP_054558672.1 I595_RS04620 acyl-CoA dehydrogenase
Query= SwissProt::Q2LQN9 (414 letters) >NCBI__GCF_001306415.1:WP_054558672.1 Length = 380 Score = 295 bits (756), Expect = 1e-84 Identities = 159/376 (42%), Positives = 243/376 (64%), Gaps = 3/376 (0%) Query: 37 LTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTGM 96 LTEEQ+++ + ++ A E+ P IE D+ +FP A+LG + +V +YGG+G+ Sbjct: 5 LTEEQQMVQQAAKDFAQNELLPGIIERDDAQAFPKEQVKKMAELGFMGMMVDSKYGGSGL 64 Query: 97 DITTFAMVLEEIGKVCASTALMLLAQADGML-SIILDGSPALKEKYLPRFGEKSTLMTAF 155 D ++ +V+EE+ K+ AS+++++ + + G+ A KEKYL R ++ AF Sbjct: 65 DTLSYVLVMEELSKIDASSSVIVSVNNSLVCWGLETFGTEAQKEKYLSRLAT-GEIIGAF 123 Query: 156 AATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGMST 215 +EP AGSD + KT A+ KGD Y+ING K +ITNG+ A++ V A TD KG KG++ Sbjct: 124 CLSEPEAGSDATSQKTTAIDKGDHYLINGTKNWITNGNSAEVYLVIAQTDVEKGHKGINA 183 Query: 216 FVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSINR 275 +VE+GT G G E KMG+R L F D++VP EN +GE+G GF + M L+ R Sbjct: 184 LIVEKGTDGFEIGPKENKMGIRSSDTHSLLFNDVKVPKENRIGEDGFGFKFAMKTLAGGR 243 Query: 276 VFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRKAT 335 + A+QA+GIA GA E A+++++ER+ FG I + I F +ADM T+++AAR LV +A Sbjct: 244 IGIAAQALGIAAGAYELALKYSKERKAFGTEICNHQAIAFKLADMHTKIQAARHLVYQAA 303 Query: 336 TLLDAKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKLTQIY 395 D K L G MAK +A++TAM+V T+AVQ+ GG+G++++Y VER+MR+AK+TQIY Sbjct: 304 WDKD-NGKDYTLSGAMAKLYAAETAMEVATEAVQIHGGNGFVKDYHVERLMRDAKITQIY 362 Query: 396 TGTNQITRMVTGRSLL 411 GT++I ++V RS+L Sbjct: 363 EGTSEIQKIVISRSIL 378 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 380 Length adjustment: 31 Effective length of query: 383 Effective length of database: 349 Effective search space: 133667 Effective search space used: 133667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory