Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_054560113.1 I595_RS14190 ATP-binding cassette domain-containing protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_001306415.1:WP_054560113.1 Length = 227 Score = 71.2 bits (173), Expect = 2e-17 Identities = 63/219 (28%), Positives = 104/219 (47%), Gaps = 11/219 (5%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 +LK+ V F L V +E+ GE V +IG G+GKS+ + T+ G G + Sbjct: 5 ILKLQDVAIFQKENLILNHVTLEVKKGEFVYVIGKTGSGKSSFMKTLYGDLPINSGEGSI 64 Query: 61 EGQDITQMPTYELV----RLGIAQSPEGRRIFPRMSVLENLQMG-SITAKPGSFANE--L 113 ++ + ++ +LGI + ++ P ++ NL+ T S + + Sbjct: 65 VDFNLKTLKEKDIPYLRRKLGIVF--QDFKLLPDRNINNNLKFVLKATGWKDSVKMDAKI 122 Query: 114 ERVLTLFPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIF 173 E VL+ +K + + +SGGEQQ +AI RAL++ P L+L DEP+ L P +I Sbjct: 123 EEVLSKVG-MKTKGFKFPHELSGGEQQRIAIARALLNDPELILADEPTGNLDPQTSVEIM 181 Query: 174 QAVKDINREQKMTVFMVEQNAFHALKLAHRGYVMVNGKV 212 + ++DIN E T+ M + LK H+ N KV Sbjct: 182 KVLQDIN-ENGRTIIMATHDYALILKYPHKTLKCDNSKV 219 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 227 Length adjustment: 23 Effective length of query: 213 Effective length of database: 204 Effective search space: 43452 Effective search space used: 43452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory