Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_054559844.1 I595_RS12830 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001306415.1:WP_054559844.1 Length = 221 Score = 75.9 bits (185), Expect = 7e-19 Identities = 58/191 (30%), Positives = 94/191 (49%), Gaps = 23/191 (12%) Query: 41 VKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDSIGQLAP-HQIALRGSVR-- 97 V+EG ++GP+G+GK+TL N++ D+GE F + + L H+ L Sbjct: 29 VEEGEFISVMGPSGSGKSTLLNVIGMLDTFDEGEYNFLHECVHTLKEKHRANLYKEYIGF 88 Query: 98 TFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQKEERANREKAMA--MLESVG 155 FQ +L LTV EN+ + + K+ + + KAM ML+ Sbjct: 89 VFQSYHLLDDLTVQENLEMP-----------------LLYKKFKGSERKAMVADMLDRFN 131 Query: 156 LGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVNPTLIGQICEHIVNWNRQ 215 + K + LSGGQ++L+ +ARAL++NPKLIL DEP +N +I + N + Sbjct: 132 IVGKKDLFPVQLSGGQQQLVGVARALIANPKLILADEPTGNLNSQQSEEIMQLFKKLNEE 191 Query: 216 -GITFLVIEHN 225 G+T + + H+ Sbjct: 192 DGVTIIQVTHS 202 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 221 Length adjustment: 23 Effective length of query: 244 Effective length of database: 198 Effective search space: 48312 Effective search space used: 48312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory