Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_054559834.1 I595_RS12780 ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_001306415.1:WP_054559834.1 Length = 231 Score = 98.2 bits (243), Expect = 1e-25 Identities = 63/204 (30%), Positives = 109/204 (53%), Gaps = 11/204 (5%) Query: 4 LLEIRDVHKSFGAVK----ALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRG 59 ++ I+D+ KSF + AL+ V++ + GE VA++G +G GKSTL+ II P G Sbjct: 1 MITIKDLRKSFRTEEVETLALNNVNLHVENGEFVAIMGPSGCGKSTLLNIIGMLDNPTEG 60 Query: 60 DLVFEGKKVIFNSPNDARSL---GIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKK 116 F G +V + L + ++Q LI +L +Y N+ L + K + Sbjct: 61 SYNFAGHEVAGLKESQRTQLRKGNLGFVFQSFNLIDELTVYENVELPLIYLK---MGKAE 117 Query: 117 MMEESKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVE 176 E+ ++L+ ++I + + + LSGGQ+Q VA++RAV + K+IL DEPT L Sbjct: 118 RKEKVMQVLERMKIAHREKHFP-QQLSGGQQQRVAISRAVVTNPKLILADEPTGNLDSKN 176 Query: 177 ARKVLELARNLKKKGLGVLIITHN 200 +V+ L L ++G ++++TH+ Sbjct: 177 GIEVMNLLTELNQEGTTIVMVTHS 200 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 231 Length adjustment: 23 Effective length of query: 228 Effective length of database: 208 Effective search space: 47424 Effective search space used: 47424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory