Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_054559834.1 I595_RS12780 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_001306415.1:WP_054559834.1 Length = 231 Score = 83.2 bits (204), Expect = 4e-21 Identities = 65/200 (32%), Positives = 105/200 (52%), Gaps = 13/200 (6%) Query: 26 ALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVFEGRDITRMPTHEIAR 85 AL V++HV GE V+++G +G GKSTL+ I GS F G ++ + + + Sbjct: 20 ALNNVNLHVENGEFVAIMGPSGCGKSTLLNIIGMLDNPTEGSYNFAGHEVAGLKESQRTQ 79 Query: 86 LR---IAQSPEGRRIFPRMTVLENLQMGAGLDNLK-HFAEDVEKIFTLFPRLKERHAQR- 140 LR + + + +TV EN+++ L LK AE EK+ + R+K H ++ Sbjct: 80 LRKGNLGFVFQSFNLIDELTVYENVEL--PLIYLKMGKAERKEKVMQVLERMKIAHREKH 137 Query: 141 -GGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLNEAEGLTVFL 199 LSGG+QQ ++I RA++ PKL+L DEP+ L + + +LN+ EG T+ + Sbjct: 138 FPQQLSGGQQQRVAISRAVVTNPKLILADEPTGNLDSKNGIEVMNLLTELNQ-EGTTIVM 196 Query: 200 VEQNAFAALRLSHRAYVMVN 219 V + R SH A+ +VN Sbjct: 197 VTHSD----RDSHYAHRVVN 212 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 231 Length adjustment: 23 Effective length of query: 224 Effective length of database: 208 Effective search space: 46592 Effective search space used: 46592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory