Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_054559834.1 I595_RS12780 ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_001306415.1:WP_054559834.1 Length = 231 Score = 139 bits (349), Expect = 7e-38 Identities = 83/205 (40%), Positives = 123/205 (60%), Gaps = 6/205 (2%) Query: 38 LRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTSDLKNIDKV- 96 L ++NL V GE + I GPSG GKST++ I L+ G G E+ LK + Sbjct: 21 LNNVNLHVENGEFVAIMGPSGCGKSTLLNIIGMLDNPTEGSYNFAGHEVAG-LKESQRTQ 79 Query: 97 --RSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQAQKY 154 + +G VFQ FNL LT+ EN+ L I++ K+ K E +E M LE++KI + + + Sbjct: 80 LRKGNLGFVFQSFNLIDELTVYENVELPLIYL-KMGKAERKEKVMQVLERMKIAHREKHF 138 Query: 155 PGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQLAEEGMTMLCVT 214 P QLSGGQQQRVAI+R++ PK++L DEPT LD + EV++ + +L +EG T++ VT Sbjct: 139 PQQLSGGQQQRVAISRAVVTNPKLILADEPTGNLDSKNGIEVMNLLTELNQEGTTIVMVT 198 Query: 215 HEMGFAQAVANRVIFMADGQIVEQN 239 H + A+RV+ + DGQI ++ Sbjct: 199 HSDRDSH-YAHRVVNLFDGQIATES 222 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 231 Length adjustment: 24 Effective length of query: 239 Effective length of database: 207 Effective search space: 49473 Effective search space used: 49473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory