Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_054557366.1 I595_RS00125 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_001306415.1:WP_054557366.1 Length = 228 Score = 138 bits (348), Expect = 8e-38 Identities = 76/205 (37%), Positives = 129/205 (62%), Gaps = 7/205 (3%) Query: 16 VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNNLVLNHKNKIE--- 72 VL++++ S+ GE I+GPSGSGK+T + GL++ G V + + LN N+ E Sbjct: 23 VLEDVSFSIDTGETFAIVGPSGSGKTTLLGLCAGLDQTDQGTVHLCGVALNELNEDERAL 82 Query: 73 ICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYLKVVGLLDKANVY 132 + + +FQ+F L P +T L+N+ + P++LQ +K A + L+ VGL D+ + Y Sbjct: 83 LRNREVGFIFQNFQLLPTLTALENVAV-PLELQ--GQKNTHGIAAELLEKVGLQDRKHHY 139 Query: 133 PATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTTMVVV 192 P+ LSGG+QQRVA+AR+ + + DEPT LD ET Q+V++++ +++ ++ TT+V+V Sbjct: 140 PSQLSGGEQQRVALARAFSSTPSILFADEPTGNLDSETGQKVVELLFDLNKEAGTTLVIV 199 Query: 193 THEMGFAKEVADRIIFMEDGAIVEE 217 TH+M A++ RI+ ++ G +V E Sbjct: 200 THDMELAQK-TQRILKLKGGKVVTE 223 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 228 Length adjustment: 23 Effective length of query: 219 Effective length of database: 205 Effective search space: 44895 Effective search space used: 44895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory