Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_054560113.1 I595_RS14190 ATP-binding cassette domain-containing protein
Query= TCDB::Q9WXN4 (268 letters) >NCBI__GCF_001306415.1:WP_054560113.1 Length = 227 Score = 100 bits (249), Expect = 3e-26 Identities = 75/229 (32%), Positives = 122/229 (53%), Gaps = 10/229 (4%) Query: 7 KNLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGE 66 + + K+ + F K + + +V+ EVK+ E V ++G++GSGK++ K + LP SGE Sbjct: 3 ETILKLQDVAIFQKENL-ILNHVTLEVKKGEFVYVIGKTGSGKSSFMKTLYGDLPINSGE 61 Query: 67 IYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNK 126 ++ K +K+++ + RRK+ VFQD P + L + K S K Sbjct: 62 GSIVDFNL-KTLKEKD-IPYLRRKLGIVFQD--FKLLPDRNINNNLKFVLKATGWKDSVK 117 Query: 127 KEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMID 186 +A I+E L +VG+ K K+PH++SGG++QRI IAR + P LI+ADEPT +D Sbjct: 118 MDAK--IEEVLSKVGMKTKGF--KFPHELSGGEQQRIAIARALLNDPELILADEPTGNLD 173 Query: 187 ASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVE 235 + I+K+L+++ E G +II THD L N ++ E Sbjct: 174 PQTSVEIMKVLQDI-NENGRTIIMATHDYALILKYPHKTLKCDNSKVFE 221 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 227 Length adjustment: 24 Effective length of query: 244 Effective length of database: 203 Effective search space: 49532 Effective search space used: 49532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory