Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_054558201.1 I595_RS04455 ATP-binding cassette domain-containing protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_001306415.1:WP_054558201.1 Length = 255 Score = 107 bits (266), Expect = 4e-28 Identities = 77/254 (30%), Positives = 134/254 (52%), Gaps = 14/254 (5%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 ++EV+ L+ + G++ ++K V+ ++G+ IIG+SGSGKT + +L P Sbjct: 1 MIEVNELHKSF--GDTHVLKGVSTC---FDQGKTNLIIGQSGSGKTVFLKCLLGLFTPE- 54 Query: 105 KIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGE 164 G + ++G +T E R L +++ V Q S AL + + E + Sbjct: 55 ---EGTISYSGQIYADLTSREQRDLR-QEMGMVFQGS--ALFDSMTVEENVMFPMEMFTK 108 Query: 165 ADKKRVIERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTS 224 K + +RA+E+L+ V L A K +P ++SGGM++RV IA ++++NPK + DEP S Sbjct: 109 TAKSDMQDRANEVLQRVNLVDAH--KKFPSEISGGMQKRVAIARAIVMNPKYLFCDEPNS 166 Query: 225 ALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEII 284 LD L+ LI+ I +E +T V THD+ ++ +I +++ + +G+ EG EI Sbjct: 167 GLDPKTAILIDNLIQEITEEFNITTVINTHDMNSVMEIGEKIVFLKQGHKEWEGTKREIF 226 Query: 285 KSPLNPYTSLLVSS 298 K+ T + SS Sbjct: 227 KTDNKAVTDFVYSS 240 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 255 Length adjustment: 27 Effective length of query: 335 Effective length of database: 228 Effective search space: 76380 Effective search space used: 76380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory