Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_054558201.1 I595_RS04455 ATP-binding cassette domain-containing protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_001306415.1:WP_054558201.1 Length = 255 Score = 134 bits (337), Expect = 2e-36 Identities = 84/235 (35%), Positives = 124/235 (52%), Gaps = 13/235 (5%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 +EV +LHK +G VLKGVS G IIG SGSGK+ FL+C+ L P G I Sbjct: 2 IEVNELHKSFGDTHVLKGVSTCFDQGKTNLIIGQSGSGKTVFLKCLLGLFTPEEGTI--- 58 Query: 64 NEELKLVANKDGALKAADPKQLQR-MRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMS 122 + G + A + QR +R + MVFQ L+ MT EN+M + Sbjct: 59 --------SYSGQIYADLTSREQRDLRQEMGMVFQGSALFDSMTVEENVMFPMEMFTKTA 110 Query: 123 KTEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP 182 K++ +++A L +V + +P +SGG Q+RVAIARA+ M P+ + DEP S LDP Sbjct: 111 KSDMQDRANEVLQRVNLVDAHKKFPSEISGGMQKRVAIARAIVMNPKYLFCDEPNSGLDP 170 Query: 183 ELVGDVLKVMQALAQE-GRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREV 236 + + ++Q + +E T V+ TH+M E+ ++VFL +G E G RE+ Sbjct: 171 KTAILIDNLIQEITEEFNITTVINTHDMNSVMEIGEKIVFLKQGHKEWEGTKREI 225 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory