Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_054557498.1 I595_RS00860 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_001306415.1:WP_054557498.1 Length = 219 Score = 129 bits (324), Expect = 7e-35 Identities = 77/219 (35%), Positives = 115/219 (52%), Gaps = 10/219 (4%) Query: 4 VTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSG---GAI 60 +T + K YG L+V+ G+ + +K E I++VGPSG GK+T L+++ L+ S +I Sbjct: 2 ITATNIKKNYGDLKVLKGVSISIKKGEVISIVGPSGAGKTTLLQLVGTLDTPSNPKDSSI 61 Query: 61 EIGGRKVNDLPP------RARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRV 114 I G V DL R NI +FQ + L P T EN+ I P + + R Sbjct: 62 MINGVDVTDLRDKQLAKFRNENIGFIFQFHQLLPEFTALENVCIPAFIKKTPKAKAEVRG 121 Query: 115 AEAAAILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRT 174 E L L+ + RP +LSGG++QRVA+ RA++ P V DEP NLD++ + Sbjct: 122 RELLDFLGLSQRYDHRPRELSGGEQQRVAVARALINNPSVIFADEPSGNLDSESAENLHQ 181 Query: 175 EIKKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIE 213 KL T + VTH++ E ++DR +IM DG I+ Sbjct: 182 LFFKLREEFGQTFVIVTHNK-ELANMADRKLIMVDGQIQ 219 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 219 Length adjustment: 26 Effective length of query: 339 Effective length of database: 193 Effective search space: 65427 Effective search space used: 65427 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory