Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_054559695.1 I595_RS12125 glucose 1-dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_001306415.1:WP_054559695.1 Length = 245 Score = 127 bits (320), Expect = 2e-34 Identities = 78/248 (31%), Positives = 128/248 (51%), Gaps = 7/248 (2%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKA 77 RLK+K+ ++TG A+GIGEAI FA + A ++I D+ E+ E VA RG Sbjct: 2 RLKDKIAIVTGGARGIGEAITELFAKEGATVIIIDV-LEEGEEVAKRIATRGGKASYHSV 60 Query: 78 DVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGC 137 V++++ + + HG+ID+L+N AG+ R +M+ +W ++L G + Sbjct: 61 SVTDKEAITRLFASVYNTHGKIDILINNAGITKDRTLEKMSIPEWDAVIDVNLKGVFICT 120 Query: 138 KAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 +AV+P M Q G I++ AS G Y K G++ +++ +E G+ NA Sbjct: 121 QAVVPYMKAQQYGRIVSAASNVGLRGNFGQTNYAATKAGVIAMSKTWTMELGKYGITANA 180 Query: 198 IAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINA 257 IAPG+ T + P + + P + QP+++A ++LASDEA F++ Sbjct: 181 IAPGFTLTDMVAKI------PEQQIEAIKASIPLKTAAQPLDIAYGYLYLASDEARFVSG 234 Query: 258 SCITIDGG 265 C+TIDGG Sbjct: 235 ICLTIDGG 242 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 245 Length adjustment: 24 Effective length of query: 248 Effective length of database: 221 Effective search space: 54808 Effective search space used: 54808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory