Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_054559699.1 I595_RS12145 SDR family oxidoreductase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_001306415.1:WP_054559699.1 Length = 251 Score = 139 bits (351), Expect = 5e-38 Identities = 79/250 (31%), Positives = 131/250 (52%), Gaps = 7/250 (2%) Query: 22 KVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVVAIKADVSR 81 KVV++TGA GIG A FA+ A +++SDI ++ A ++ G ++ DV++ Sbjct: 6 KVVIITGAGSGIGAATAQLFAAYNANVIVSDINLDQAGLTARDIKKSGGMATVVQTDVTQ 65 Query: 82 QQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTE---EDWHRCFAIDLDGAWYGCK 138 + A+ + G++DV+VN AG+ + L+ E +DWH A++ G +YG + Sbjct: 66 FDQVKALVTDTVTTFGQLDVMVNNAGIGG-KHQLKTAEHDHDDWHNVIAVNQTGVFYGMQ 124 Query: 139 AVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVNAI 198 L QM+ QG G+I+N+AS Y +K+ ++G+T++ +EY K IR+NA+ Sbjct: 125 TALQQMMLQGQGAIVNVASLAGLKASGNNLSYSASKYAVVGMTKSAALEYGRKNIRINAV 184 Query: 199 APGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFINAS 258 PG+ + L A + + P R G+ E+A +LASD + FI Sbjct: 185 CPGFTHSALLNQL---LASSDTMEKNLKRMIPMGRFGEAKEIAEAICWLASDHSKFITGQ 241 Query: 259 CITIDGGRSV 268 IT+DGG S+ Sbjct: 242 TITLDGGTSL 251 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 251 Length adjustment: 25 Effective length of query: 247 Effective length of database: 226 Effective search space: 55822 Effective search space used: 55822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory