Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_054559834.1 I595_RS12780 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_001306415.1:WP_054559834.1 Length = 231 Score = 130 bits (326), Expect = 4e-35 Identities = 85/219 (38%), Positives = 125/219 (57%), Gaps = 12/219 (5%) Query: 4 LEIRNIRK--RYGEVETL--KGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGD 59 + I+++RK R EVETL +++ +E+GEF+ ++G SGCGKSTLLNII L P+ G Sbjct: 2 ITIKDLRKSFRTEEVETLALNNVNLHVENGEFVAIMGPSGCGKSTLLNIIGMLDNPTEGS 61 Query: 60 ILIGERSVLGVHPKDR------DIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKA 113 V G+ R ++ VFQS+ L L+V N+ L ++ +AE + Sbjct: 62 YNFAGHEVAGLKESQRTQLRKGNLGFVFQSFNLIDELTVYENVELPLIYLKMGKAERKEK 121 Query: 114 VRDTARLLQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMR 173 V ++I + P QLSGGQ+QRVAI RA+V NP++ L DEP NLD+K +E+ Sbjct: 122 VMQVLERMKIAHREKHFPQQLSGGQQQRVAISRAVVTNPKLILADEPTGNLDSKNGIEVM 181 Query: 174 TELKRLHQMLRTTVVYVTHDQIEAMTLATRIAVMRDGRI 212 L L+Q TT+V VTH ++ A R+ + DG+I Sbjct: 182 NLLTELNQE-GTTIVMVTHSDRDS-HYAHRVVNLFDGQI 218 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 231 Length adjustment: 26 Effective length of query: 334 Effective length of database: 205 Effective search space: 68470 Effective search space used: 68470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory