Align ABC transporter related (characterized, see rationale)
to candidate WP_054559834.1 I595_RS12780 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_001306415.1:WP_054559834.1 Length = 231 Score = 148 bits (374), Expect = 9e-41 Identities = 87/231 (37%), Positives = 137/231 (59%), Gaps = 15/231 (6%) Query: 9 LSVKNIHKSFGDHHV----LKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGS 64 +++K++ KSF V L ++L G+ ++I+G SG GKST L + +L+ P +GS Sbjct: 2 ITIKDLRKSFRTEEVETLALNNVNLHVENGEFVAIMGPSGCGKSTLLNIIGMLDNPTEGS 61 Query: 65 VSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQ 124 + AG E+ L+ S R Q+ + LG VFQ+FNL +TV EN +E P+ Sbjct: 62 YNFAGHEV-------AGLKESQRTQLRK--GNLGFVFQSFNLIDELTVYEN-VELPLIYL 111 Query: 125 KRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSA 184 K +AE E+ +L ++ +A + H+P LSGGQQQRVAI+RA+ +PK++L DEPT Sbjct: 112 KMGKAERKEKVMQVLERMKIAHREKHFPQQLSGGQQQRVAISRAVVTNPKLILADEPTGN 171 Query: 185 LDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEAD 235 LD + EV+ ++ L +EG T+++VTH H ++RV+ L GQ+ + Sbjct: 172 LDSKNGIEVMNLLTELNQEGTTIVMVTHS-DRDSHYAHRVVNLFDGQIATE 221 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 231 Length adjustment: 24 Effective length of query: 239 Effective length of database: 207 Effective search space: 49473 Effective search space used: 49473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory