Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_054558672.1 I595_RS04620 acyl-CoA dehydrogenase
Query= reanno::WCS417:GFF2715 (375 letters) >NCBI__GCF_001306415.1:WP_054558672.1 Length = 380 Score = 351 bits (901), Expect = e-101 Identities = 177/371 (47%), Positives = 258/371 (69%) Query: 5 EEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTGY 64 EEQ + AA+ FAQ L P E D FPKE + +MAELGF GM+V ++GG Sbjct: 7 EEQQMVQQAAKDFAQNELLPGIIERDDAQAFPKEQVKKMAELGFMGMMVDSKYGGSGLDT 66 Query: 65 LAYAMALEEIAAGDGACSTIMSVHNSVGCVPVLKFGNDQQKEQFLKPLASGAMLGAFALT 124 L+Y + +EE++ D + S I+SV+NS+ C + FG + QKE++L LA+G ++GAF L+ Sbjct: 67 LSYVLVMEELSKIDASSSVIVSVNNSLVCWGLETFGTEAQKEKYLSRLATGEIIGAFCLS 126 Query: 125 EPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPAAGKRGISAFIV 184 EP+AGSDA+S KT A +GDHY++NG K +IT+G +A V +V A TD G +GI+A IV Sbjct: 127 EPEAGSDATSQKTTAIDKGDHYLINGTKNWITNGNSAEVYLVIAQTDVEKGHKGINALIV 186 Query: 185 PTDSPGYSVARVEDKLGQHASDTCQILFEDVKVPVANRLGEEGEGYKIALANLEGGRVGI 244 + G+ + E+K+G +SDT +LF DVKVP NR+GE+G G+K A+ L GGR+GI Sbjct: 187 EKGTDGFEIGPKENKMGIRSSDTHSLLFNDVKVPKENRIGEDGFGFKFAMKTLAGGRIGI 246 Query: 245 ASQAVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALR 304 A+QA+G+A A+E A Y++ER++FG I HQA+AF+LADM T+I AR +V+ AA + Sbjct: 247 AAQALGIAAGAYELALKYSKERKAFGTEICNHQAIAFKLADMHTKIQAARHLVYQAAWDK 306 Query: 305 DSGKPALVEASMAKLFASEMAEKVCSAALQTLGGYGYLSDFPLERIYRDVRVCQIYEGTS 364 D+GK + +MAKL+A+E A +V + A+Q GG G++ D+ +ER+ RD ++ QIYEGTS Sbjct: 307 DNGKDYTLSGAMAKLYAAETAMEVATEAVQIHGGNGFVKDYHVERLMRDAKITQIYEGTS 366 Query: 365 DIQRMVISRNL 375 +IQ++VISR++ Sbjct: 367 EIQKIVISRSI 377 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory