Align enoyl-CoA hydratase (EC 4.2.1.17); DELTA3,5-DELTA2,4-dienoyl-CoA isomerase (EC 5.3.3.21) (characterized)
to candidate WP_054558757.1 I595_RS07175 enoyl-CoA hydratase
Query= BRENDA::P14604 (290 letters) >NCBI__GCF_001306415.1:WP_054558757.1 Length = 260 Score = 194 bits (492), Expect = 2e-54 Identities = 113/248 (45%), Positives = 151/248 (60%), Gaps = 9/248 (3%) Query: 46 SVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTG-GEKAFAAGADIKEMQ 104 ++G I ++RPK LNAL IEEL+ A + + D + AI++TG GEKAF AGADI E Sbjct: 13 NLGTITIDRPKKLNALNKATIEELHVAFKELDADKNIKAIIITGNGEKAFVAGADISEFA 72 Query: 105 NRTFQDCYSGKFLSH-----WDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQ 159 + F + G + +D I + PVIAAVNG+ALGGG ELAM C A A+ Sbjct: 73 H--FSEKEGGVLAAKGQELLFDFIAHLSTPVIAAVNGFALGGGLELAMACHFRVASSNAK 130 Query: 160 FGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLV 219 G PE+ LG IPG GGTQRL + VGK AMEM++T ISA+ A GLV+ + E L+ Sbjct: 131 MGLPEVSLGVIPGYGGTQRLPQLVGKGRAMEMIMTAGMISAEQALDYGLVNYVVEPEDLM 190 Query: 220 EEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAF 279 + A KI+NNS + +A A ++NA + T G E + F + F T+D +EG +AF Sbjct: 191 PLCTKLASKISNNSPVAIAHAINAINAGYSFN-TNGYAAEIEAFGACFGTNDFKEGTTAF 249 Query: 280 VEKRKANF 287 +EKRKANF Sbjct: 250 LEKRKANF 257 Lambda K H 0.319 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 260 Length adjustment: 25 Effective length of query: 265 Effective length of database: 235 Effective search space: 62275 Effective search space used: 62275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory