Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_054559844.1 I595_RS12830 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_001306415.1:WP_054559844.1 Length = 221 Score = 115 bits (287), Expect = 1e-30 Identities = 81/223 (36%), Positives = 121/223 (54%), Gaps = 18/223 (8%) Query: 4 VQLQNVTKAW-----GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG 58 +QL N+ K W + + KDINLD+ EGEF+ +GPSG GKSTLL +I L+T G Sbjct: 3 LQLNNIFK-WVNSGGQRIFLLKDINLDVEEGEFISVMGPSGSGKSTLLNVIGMLDTFDEG 61 Query: 59 DL-FIGE-----KRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQ 112 + F+ E K + + +G VFQSY L L+V EN+ L KK ++ Sbjct: 62 EYNFLHECVHTLKEKHRANLYKEYIGFVFQSYHLLDDLTVQENLEMPLLY---KKFKGSE 118 Query: 113 RVNQVAEVLQLAHLLDRK---PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALR 169 R VA++L +++ +K P LSGGQ+Q V + R L+A P + L DEP NL++ Sbjct: 119 RKAMVADMLDRFNIVGKKDLFPVQLSGGQQQLVGVARALIANPKLILADEPTGNLNSQQS 178 Query: 170 VQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRV 212 ++ +L++ G T+I VTH + A + I +LD +V Sbjct: 179 EEIMQLFKKLNEEDGVTIIQVTHSEKNAAYGSRIINLLDGRKV 221 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 221 Length adjustment: 26 Effective length of query: 345 Effective length of database: 195 Effective search space: 67275 Effective search space used: 67275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory