Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_054557498.1 I595_RS00860 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_001306415.1:WP_054557498.1 Length = 219 Score = 113 bits (283), Expect = 4e-30 Identities = 70/204 (34%), Positives = 108/204 (52%), Gaps = 10/204 (4%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLE---NVTDGAIFIGDKDVTHVAP--- 74 +K ++ I GE + +VGPSG GK+T L+++ L+ N D +I I DVT + Sbjct: 17 LKGVSISIKKGEVISIVGPSGAGKTTLLQLVGTLDTPSNPKDSSIMINGVDVTDLRDKQL 76 Query: 75 ---RDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLER 131 R+ +I +FQ + L P T EN+ I + + R E LGL++ + Sbjct: 77 AKFRNENIGFIFQFHQLLPEFTALENVCIPAFIKKTPKAKAEVRGRELLDFLGLSQRYDH 136 Query: 132 KPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVY 191 +P+ LSGG++QRVA+ RA++ NP V DEP NLD++ L+ + G T V Sbjct: 137 RPRELSGGEQQRVAVARALINNPSVIFADEPSGNLDSESAENLHQLFFKLREEFGQTFVI 196 Query: 192 VTHDQTEALTMGDRIAVLKDGYLQ 215 VTH++ E M DR ++ DG +Q Sbjct: 197 VTHNK-ELANMADRKLIMVDGQIQ 219 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 219 Length adjustment: 26 Effective length of query: 350 Effective length of database: 193 Effective search space: 67550 Effective search space used: 67550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory