Align Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (characterized)
to candidate WP_054560388.1 I595_RS15570 acetyl-CoA C-acyltransferase
Query= reanno::Marino:GFF2751 (415 letters) >NCBI__GCF_001306415.1:WP_054560388.1 Length = 391 Score = 271 bits (693), Expect = 2e-77 Identities = 163/404 (40%), Positives = 232/404 (57%), Gaps = 14/404 (3%) Query: 7 LKDAYIVDAIRTPIGRYGGALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLYGCANQA 66 +K+ IV A+RTPIG + GALS + A +GAI IK E +LD SK+D+VL G QA Sbjct: 1 MKEVVIVSAVRTPIGSFMGALSTIPAPKIGAIAIKGAMENI-NLDPSKVDEVLMGQVVQA 59 Query: 67 GEDNRDVARMSLLLAGLPVDVPGSTINRLCGSGMDAVGSAARAIRTGETQLMIAGGVESM 126 G AR + + AG+P VP +T+N++C SGM V AA++I G+ ++IAGG+E+M Sbjct: 60 GTGQAP-ARQAAIFAGIPDSVPCTTVNKVCASGMKTVMQAAQSIALGDANIIIAGGMENM 118 Query: 127 SRAPFVMGKADSAFSRKAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADFGISRED 186 S P + + + D L Y ++M A+ A + SRED Sbjct: 119 SLIPHYVHLRTGTKFGPSSLVDG-----MQKDGLVDVYDQNAMGVCADLCAKEHNFSRED 173 Query: 187 QDAFALRSQQRTAAAQKEGRLAAEITPVTIPRRKQDPLVVDTDEHPRETSLEKLASLPTP 246 QD +A++S +R+AAA KEG+ E+ PV++P+R+ +PLV+ DE + LEK+ L Sbjct: 174 QDNYAIQSYKRSAAAWKEGKFHNEVIPVSVPQRRGEPLVITEDEEFKNVKLEKIPGLRAA 233 Query: 247 FRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVEPRIMGFGPAP 306 F ++GTVTA NAS +NDGA AL+L + + L P A + A A EP+ PA Sbjct: 234 FTKDGTVTAANASTINDGAAALVLMSREKAMELGLTPLATIKGYADAAQEPKWFTTAPAK 293 Query: 307 ATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGGAIALGHPLGM 366 A K L AGL L D+D E NEAFA LA + L L DD VN NGGA++LGHPLG Sbjct: 294 ALPKALDKAGLTLKDVDYFEFNEAFAVVGLANMKLLNLKDDT--VNVNGGAVSLGHPLGC 351 Query: 367 SGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIER 410 SGAR++ T ++ L++ + A+ +C G G AL+++R Sbjct: 352 SGARILVTLISVLQQNN-----AKIGAAAICNGGGGASALVLQR 390 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 415 Length of database: 391 Length adjustment: 31 Effective length of query: 384 Effective length of database: 360 Effective search space: 138240 Effective search space used: 138240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory