Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_054558757.1 I595_RS07175 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_001306415.1:WP_054558757.1 Length = 260 Score = 95.1 bits (235), Expect = 1e-24 Identities = 74/248 (29%), Positives = 121/248 (48%), Gaps = 6/248 (2%) Query: 12 ESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITG-ADNFFCAGGNLN 70 E + +T+ P NAL+ A ++ D +I+A++ITG + F AG +++ Sbjct: 10 EERNLGTITIDRPKKLNALNKATIEELHVAFKELDADKNIKAIIITGNGEKAFVAGADIS 69 Query: 71 RLLENRAKDPSV-QAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAA 129 K+ V A+ +LL ++I+ L S PVIAAV+G A G G LA+AC VA+ Sbjct: 70 EFAHFSEKEGGVLAAKGQELLFDFIAHL---STPVIAAVNGFALGGGLELAMACHFRVAS 126 Query: 130 DDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKP 189 +AK + +G+ P GG+ L Q + + A E+++ I A + + G+VN + +P Sbjct: 127 SNAKMGLPEVSLGVIPGYGGTQRLPQLVGKGRAMEMIMTAGMISAEQALDYGLVNYVVEP 186 Query: 190 GTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEG 249 A ++ SP ++A + AG + AE + F A + EG Sbjct: 187 EDLMPLCTKLASKISNNSPVAIAHAINAI-NAGYSFNTNGYAAEIEAFGACFGTNDFKEG 245 Query: 250 ISAFLEKR 257 +AFLEKR Sbjct: 246 TTAFLEKR 253 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 260 Length adjustment: 25 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory