Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_054559146.1 I595_RS09190 ornithine--oxo-acid transaminase
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_001306415.1:WP_054559146.1 Length = 425 Score = 200 bits (509), Expect = 7e-56 Identities = 138/399 (34%), Positives = 201/399 (50%), Gaps = 46/399 (11%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 D +G+++ D L + N GH +P +++A++NQ L S+ + ML K Sbjct: 41 DVEGKKYYDFLSAYSAVNQGHCHPKIINALKNQAENLTLTSRAFYND---MLGKY----- 92 Query: 138 PGKLKYSFF-------CNSGTESVEAALKLAK--AYQS---PRGKFTFIATSGAFHGKSL 185 K FF N+G E+VE ALKLA+ Y+ P K I FHG+++ Sbjct: 93 -EKFATEFFGFDKLLPMNTGAEAVETALKLARKWGYEKKGIPANKAKIIVCQNNFHGRTI 151 Query: 186 GALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGG 245 +SA+ + F P PG + + +I A+ AL + + VAA ++EPIQGE G Sbjct: 152 SIISASNDPVATENFGPFTPGMLSIRYNDIAALAEALKD-----EHVAAFMVEPIQGEAG 206 Query: 246 VILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFA------CEHEN------VQP 293 V +P Y+ +LC L I DEVQTG+ RTG++ A C +N V+P Sbjct: 207 VYVPDENYIKEAFELCKSKNVLFIADEVQTGIARTGRLLASCGNCSCSDKNCSGVPDVKP 266 Query: 294 DILCLAKALGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ 353 D+L L KA+ GGV P+ A +A ++ V+ P H +TFGGNPLACA A+A + V+ E+ Sbjct: 267 DVLILGKAISGGVFPVSAVLANNDIMEVI--RPGNHGSTFGGNPLACAVAIAALEVVKEE 324 Query: 354 NLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNE---IGYNFASEMFR 410 NL A Q G++ ++L E DLV+ RGKG+L AI D E +N + Sbjct: 325 NLAENAFQLGELFRSEMQKLVAE-TDLVRLVRGKGLLNAIVINDTEDSSTAWNICVALKD 383 Query: 411 QRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKAL 449 +L T N IR PPL +T E+ I RK + Sbjct: 384 NGLLAKPTHGN--IIRFAPPLVMTKEELLDCISIIRKTI 420 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 18 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 425 Length adjustment: 32 Effective length of query: 427 Effective length of database: 393 Effective search space: 167811 Effective search space used: 167811 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory