Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_054559221.1 I595_RS09645 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_001306415.1:WP_054559221.1 Length = 298 Score = 112 bits (281), Expect = 7e-30 Identities = 71/233 (30%), Positives = 117/233 (50%), Gaps = 23/233 (9%) Query: 7 EVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTF 66 E +L V ++K+FG L A++D+ TI++G VYG++GPNG+GK+T +I + G F Sbjct: 2 ETILTVTNLTKKFGSLIAVNDLSFTIEKGNVYGILGPNGSGKSTTLGIILNVVNKTTGEF 61 Query: 67 ELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKG 126 ++ H+ K + + + MTA++N+ + I+ S Sbjct: 62 HWFDGS---SSTHQALKK-VGAIIERPNFYPYMTAIQNLKLVCKIKEVS----------- 106 Query: 127 FKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAA 186 + +E L+ VG+ K RT S G ++RL IA AL DP+++ LDEP Sbjct: 107 --------ETKIEEKLELVGLLDRKHSKFRTYSLGMKQRLAIASALLNDPEILILDEPTN 158 Query: 187 GMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEG 239 G++ Q+RE+I +I + TILL H + V +C V +L G ++ G Sbjct: 159 GLDPQGIHQIREIIKKIASQGTTILLASHLLDEVEKVCSHVVILRKGVKLYSG 211 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 298 Length adjustment: 25 Effective length of query: 235 Effective length of database: 273 Effective search space: 64155 Effective search space used: 64155 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory