GapMind for catabolism of small carbon sources

 

Protein WP_055437631.1 in Lacinutrix algicola AKS293

Annotation: NCBI__GCF_001418085.1:WP_055437631.1

Length: 220 amino acids

Source: GCF_001418085.1 in NCBI

Candidate for 54 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 40% 89% 142.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-glutamate catabolism gltL lo GluA aka CGL1950, component of Glutamate porter (characterized) 39% 88% 147.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 141.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 38% 85% 139.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 34% 56% 137.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 36% 61% 136 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 58% 134.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 58% 134.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 34% 54% 132.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 31% 58% 132.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 35% 59% 131.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 33% 83% 131 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 35% 89% 130.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 32% 84% 128.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 127.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 31% 59% 124.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 32% 60% 124.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 32% 55% 123.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 34% 58% 121.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 55% 120.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 52% 120.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 31% 57% 118.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 55% 115.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 55% 115.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 35% 74% 114.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-isoleucine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-leucine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-valine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 86% 106.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 32% 91% 104.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-proline catabolism HSERO_RS00900 lo ABC transporter ATP-binding protein (characterized, see rationale) 31% 88% 99 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-serine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 31% 88% 99 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-tyrosine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 31% 88% 99 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 83% 96.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 206.1

Sequence Analysis Tools

View WP_055437631.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKAENIHKYYDDLHVLKGVNVHIKKGEVVSIVGSSGAGKTTLLQILGTLDTISKTDDSS
LIINGKNISSLSEKQLAKFRNEHIGFIFQFHQLLPEFTAIENVCIPAFIKKTPKAEATKR
AKELLDFLGLSHRYNHKPNELSGGEQQRVAVARALINNPSLIFADEPSGNLDSESAENLH
SLFFKLRDEFGQTFVIVTHNEELADLADRKLVMVDGVISN

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory