Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_055436456.1 ASC41_RS09735 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_001418085.1:WP_055436456.1 Length = 303 Score = 137 bits (345), Expect = 3e-37 Identities = 81/239 (33%), Positives = 127/239 (53%), Gaps = 12/239 (5%) Query: 4 LQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEISIG 63 L + N+ S+ VLKD++ V+ GE++ +G SGCGKSTLL+V+ G D G + Sbjct: 2 LNVKNLSFSYKKTPVLKDLSFNVKPGEYLAVIGESGCGKSTLLKVLRGEYDLNNGTVFWK 61 Query: 64 GQTVTTTPPAKRGIAM-------VFQSYALYPHLSVRENMALALKQERQPKEEIAARVAE 116 + + K + + V Q + L P++SV EN+ L KEE R AE Sbjct: 62 KEEILGP---KHNLVIGYDFMKYVAQEFELEPYISVAENIGQHLSNFY--KEEKKERTAE 116 Query: 117 ASRMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEI 176 ++ L + + LSGGQ+QRVA+ RA+ PK+ L DEP S++D + + R I Sbjct: 117 LLEVVELTNLASTKVKLLSGGQKQRVALARALANAPKILLLDEPFSHIDNFKKQSLRRNI 176 Query: 177 ARLHRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIG 235 + + + + I +HD+ + + AD+++VL D +IE TP +LYN P +A F G Sbjct: 177 FKYLKDKNITCIVASHDKEDVLGFADQMMVLNDNKIEAYNTPEQLYNTPETPLIASFFG 235 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 303 Length adjustment: 27 Effective length of query: 304 Effective length of database: 276 Effective search space: 83904 Effective search space used: 83904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory